Product Description
Size: 20ul / 150ul
The CORO1B (31091-1-AP) by Proteintech is a Polyclonal antibody targeting CORO1B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
31091-1-AP targets CORO1B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HT-29 cells, MDA-MB-453 cells, NIH/3T3 cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse liver tissue, human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:4000
Immunohistochemistry (IHC): IHC : 1:50-1:500
Background Information
CORO1B (Coronin 1B) is an actin-binding protein that controls actin networks at classical lamellipodia (PMID: 32850828). Coro1B localizes to the plasma membrane, regulates lamellipodia formation, and when phosphorylated, it can no longer bind ARP2/3 and inhibit its actin nucleation abilities (PMID: 22619279).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag34813 Product name: Recombinant human CORO1B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 393-489 aa of BC006449 Sequence: REAYVPSKQRDLKISRRNVLSDSRPAMAPGSSHLGAPASTTTAADATPSGSLARAGEAGKLEEVMQELRALRALVKEQGDRICRLEEQLGRMENGDA Predict reactive species
Full Name: coronin, actin binding protein, 1B
Calculated Molecular Weight: 498 aa, 54 kDa
Observed Molecular Weight: 68 kDa
GenBank Accession Number: BC006449
Gene Symbol: CORO1B
Gene ID (NCBI): 57175
RRID: AB_3669849
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity purification
UNIPROT ID: Q9BR76
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924