Iright
BRAND / VENDOR: Proteintech

Proteintech, 31095-1-AP, Nesprin1/Syne-1 Polyclonal antibody

CATALOG NUMBER: 31095-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The Nesprin1/Syne-1 (31095-1-AP) by Proteintech is a Polyclonal antibody targeting Nesprin1/Syne-1 in WB, ELISA applications with reactivity to human, mouse samples 31095-1-AP targets Nesprin1/Syne-1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, U2OS cells, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SYNE1, also known as spectrin repeat containing nuclear envelope protein 1. It is expressed in skeletal and smooth muscle, as well as peripheral blood lymphocytes, and localizes to the nuclear membrane. Mutations in the SYNE1 gene have been associated with several diseases, including autosomal recessive spinocerebellar ataxia type 8 (also referred to as autosomal recessive cerebellar ataxia type 1 or recessive ataxia of Beauce) and Emery-Dreifuss muscular dystrophy 4, autosomal dominant. The SYNE1 gene exhibits ubiquitous expression across various tissues, including the ovary and bone marrow. The molecular weight of the SYNE1 protein can vary depending on the specific isoform. For example, the full-length nesprin-1 isoform, also known as nesprin-1 giant, has 8797 amino acids and a molecular weight of approximately 1000 kDa. Another isoform, nesprin-1α2, has a molecular weight of about 120 kDa (PMID: 27782104). The protein has other isoforms with molecular weights of 380 kDa, 167 kDa and 642 kDa respectively. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34809 Product name: Recombinant human SYNE1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 8260-8450 aa of BC039121 Sequence: SLAQPLRSERSGRDTPASVDSIPLEWDHDYDLSRDLESAMSRALPSEDEEGQDDKDFYLRGAVGLSGDHSALESQIRQLGKALDDSRFQIQQTENIIRSKTPTGPELDTSYKGYMKLLGECSSSIDSVKRLEHKLKEEEESLPGFVNLHSTETQTAGVIDRWELLQAQALSKELRMKQNLQKWQQFNSDLN Predict reactive species Full Name: spectrin repeat containing, nuclear envelope 1 Observed Molecular Weight: 120 kDa, 367 kDa, 642 kDa, 1000 kDa GenBank Accession Number: BC039121 Gene Symbol: SYNE1 Gene ID (NCBI): 23345 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8NF91 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924