Proteintech, 31096-1-AP, NMI Polyclonal antibody

Size: 20ul / 150ul The NMI (31096-1-AP) by Proteintech is a Polyclonal antibody targeting NMI in WB, ELISA applications with reactivity to human, rat samples 31096-1-AP targets NMI in WB, ELISA applications and shows reactivity with human, rat samples. Tested Applications Positive WB detected in: HeLa cells, PC-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Background Information N-Myc and STAT Interactor protein (NMI) is an interferon inducible protein that interacts with NMYC and CMYC (members of the oncogene Myc family), and other transcription factors containing a Zip, HLH, or HLH-Zip motif. It is widely involved in the process of tumor growth, progression, and metastasis. Specification Tested Reactivity: human, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34759 Product name: Recombinant human NMI protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of BC001268 Sequence: MEADKDDTQQILKEHSPDEFIKDEQNKGLIDEITKKNIQLKKEIQKLETELQEATKEFQIKEDIPETKMKFLSVETPENDSQLSNISCSFQVSSKVPYEI Predict reactive species Full Name: N-myc (and STAT) interactor Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 37 kDa GenBank Accession Number: BC001268 Gene Symbol: NMI Gene ID (NCBI): 9111 RRID: AB_3669853 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q13287 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.