Iright
BRAND / VENDOR: Proteintech

Proteintech, 31098-1-AP, EGR1 Polyclonal antibody

CATALOG NUMBER: 31098-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EGR1 (31098-1-AP) by Proteintech is a Polyclonal antibody targeting EGR1 in WB, ELISA applications with reactivity to Human samples 31098-1-AP targets EGR1 in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information EGR1, also named as Early growth response protein 1, is a 543 amino acid protein, which belongs to the EGR C2H2-type zinc-finger protein family. EGR1 as a transcriptional regulator recognizes and binds to the DNA sequence 5'-GCG(T/G)GGGCG-3'(EGR-site) in the promoter region of target genes and binds double-stranded target DNA, irrespective of the cytosine methylation status. EGR1 regulates the transcription of numerous target genes, and thereby plays an important role in regulating the response to growth factors, DNA damage, and ischemia. EGR1 activates expression of p53/TP53 and TGFB1, and thereby helps prevent tumor formation and plays a role in the regulation of cell survival, proliferation and cell death. Egr1 is suggested to be a 55-kDa protein according to the translation of its coding sequence. Analysis of cytoplasmic and nuclear fractions of normal and irradiated native CNS tissue by Western blotting revealed a 110-kDa band for Egr1 localized in the cytoplasm and a 75-kDa version for the nuclear Egr1(PMID: 17497096) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33440 Product name: Recombinant human EGR1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 414-543 aa of BC073983 Sequence: HTKIHLRQKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGFPSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC* Predict reactive species Full Name: early growth response 1 Calculated Molecular Weight: 543 aa, 58 kDa Observed Molecular Weight: 70-80 kDa GenBank Accession Number: BC073983 Gene Symbol: EGR1 Gene ID (NCBI): 1958 RRID: AB_3669855 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P18146 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924