Iright
BRAND / VENDOR: Proteintech

Proteintech, 31119-1-AP, CD14 Polyclonal antibody

CATALOG NUMBER: 31119-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CD14 (31119-1-AP) by Proteintech is a Polyclonal antibody targeting CD14 in WB, ELISA applications with reactivity to mouse samples 31119-1-AP targets CD14 in WB, ELISA applications and shows reactivity with mouse samples. Tested Applications Positive WB detected in: J774A.1 cells, RAW 264.7 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CD14 is a 50-55 kDa glycosylphosphatidylinositol-anchored glycoprotein preferentially expressed on monocytes and macrophages, and at lower levels on granulocytes (PMID: 3385210; 2462937; 7685797). CD14 can also exist as a soluble protein. CD14 acts as a co-receptor for bacterial liposaccharides (LPS) (PMID: 1698311). It plays a major role in the inflammatory response of monocytes to LPS. Specification Tested Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0847 Product name: Recombinant mouse CD14 protein Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-6*HIS Domain: 16-345 aa of NM_009841.4 Sequence: SPAPPEPCELDEESCSCNFSDPKPDWSSAFNCLGAADVELYGGGRSLEYLLKRVDTEADLGQFTDIIKSLSLKRLTVRAARIPSRILFGALRVLGISGLQELTLENLEVTGTAPPPLLEATGPDLNILNLRNVSWATRDAWLAELQQWLKPGLKVLSIAQAHSLNFSCEQVRVFPALSTLDLSDNPELGERGLISALCPLKFPTLQVLALRNAGMETPSGVCSALAAARVQLQGLDLSHNSLRDAAGAPSCDWPSQLNSLNLSFTGLKQVPKGLPAKLSVLDLSYNRLDRNPSPDELPQVGNLSLKGNPFLDSESHSEKFNSGVVTAGAP Predict reactive species Full Name: CD14 antigen Calculated Molecular Weight: 39 kDa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: NM_009841.4 Gene Symbol: Cd14 Gene ID (NCBI): 12475 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: P10810 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924