Iright
BRAND / VENDOR: Proteintech

Proteintech, 31159-1-AP, SC4MOL Polyclonal antibody

CATALOG NUMBER: 31159-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SC4MOL (31159-1-AP) by Proteintech is a Polyclonal antibody targeting SC4MOL in WB, ELISA applications with reactivity to human, mouse samples 31159-1-AP targets SC4MOL in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SW 1990 cells, mouse adipose tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SC4MOL(sterol C4-methyl oxidase-like), an intermediate enzyme in the cholesterol biosynthetic pathway, was included in the library based on its representation in a high confidence GEO transcriptional profiling dataset as a transcript that rapidly undergoes significant expression change in response to stimulation or inhibition of EGFR. Among the validated hits that increased cell killing by common EGFR antagonists, SC4MOL was consistently one of the most effective modulators. (PMID: 23125191) Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34758 Product name: Recombinant human SC4MOL protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 221-293 aa of BC107879 Sequence: LLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQYNAYNEKRKKFEKKTE Predict reactive species Full Name: sterol-C4-methyl oxidase-like Observed Molecular Weight: 34-36 kDa GenBank Accession Number: BC107879 Gene Symbol: SC4MOL Gene ID (NCBI): 6307 RRID: AB_3669874 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q15800 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924