Iright
BRAND / VENDOR: Proteintech

Proteintech, 31191-1-AP, COBLL1 Polyclonal antibody

CATALOG NUMBER: 31191-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The COBLL1 (31191-1-AP) by Proteintech is a Polyclonal antibody targeting COBLL1 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31191-1-AP targets COBLL1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: A431 cells Positive IHC detected in: mouse kidney tissue, human placenta tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HaCaT cells Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Cordon-blue protein-like 1 (COBLL1), a negative regulator of apoptosis, is associated with lower insulin resistance. COBLL1 is involved in the cancer cell morphogenesis to a neuron-like cell shape observed in the CRPC model cells, promoting cell growth and migration (PMID: 29686105, 29686105). COBLL1 is highly expressed in most human tissues including lung, liver, kidney, pancreas, ovary, spinal cord and brain. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34853 Product name: Recombinant human COBLL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 990-1128 aa of BC071588 Sequence: LAVVKRSQSFSKERTESPSASALVQPPANTEEGKTHSVNKFVDIPQLGVSDKENNSAHNEQNSQIPTPTDGPSFTVMRQSSLTFQSSDPEQMRQSLLTAIRSGEAAAKLKRVTIPSNTISVNGRSRLSHSMSPDAQDGH Predict reactive species Full Name: COBL-like 1 Observed Molecular Weight: 160 kDa GenBank Accession Number: BC071588 Gene Symbol: COBLL1 Gene ID (NCBI): 22837 RRID: AB_3669891 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q53SF7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924