Proteintech, 31201-1-AP, PSMG4 Polyclonal antibody

Size: 20ul / 150ul The PSMG4 (31201-1-AP) by Proteintech is a Polyclonal antibody targeting PSMG4 in WB, ELISA applications with reactivity to human samples 31201-1-AP targets PSMG4 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A431 cells, MCF-7 cells, MDA-MB-231 cells, SK-BR-3 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Background Information PSMG4 (Proteasome assembly chaperone 4), also known as C6orf86. It is expected to be located in the nucleus and cytoplasm, which interacts with PSMG3 and asociates with alpha subunits of the 20S proteasome. The molecular weight of PSMG4 is 13 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35222 Product name: Recombinant human PSMG4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-123 aa of NM_001128591.1 Sequence: MEGLVVAAGGDVSLHNFSARLWEQLVHFHVMRLTDSLFLWVGATPHLRNLAVAMCSRYDSIPVSTSLLGDTSDTTSTGLAQRLARKTNKQVFVSYNLQNTDSNFALLVENRIKEEMEAFPEKF Predict reactive species Full Name: proteasome (prosome, macropain) assembly chaperone 4 Calculated Molecular Weight: 14 kDa Observed Molecular Weight: 13 kDa GenBank Accession Number: NM_001128591.1 Gene Symbol: PSMG4 Gene ID (NCBI): 389362 RRID: AB_3669898 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5JS54 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.