Iright
BRAND / VENDOR: Proteintech

Proteintech, 31205-1-AP, CLK4 Polyclonal antibody

CATALOG NUMBER: 31205-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CLK4 (31205-1-AP) by Proteintech is a Polyclonal antibody targeting CLK4 in WB, ELISA applications with reactivity to human, mouse samples 31205-1-AP targets CLK4 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: EC109 cells, K-562 cells, mouse testis tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CDC-like kinase 4 (CLK4) is a dual-specificity kinase that can phosphorylate the tyrosine or serine/threonine residues of substrates. CLK4 belongs to the LAMMER kinase family, which includes three other characterised isoforms: CLK1-3. CLK2 and CLK4 are essential regulators of DNA damage-induced IKK and NF-κB activity (PMID: 37506701). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34446 Product name: Recombinant human CLK4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 10-130 aa of NM_020666 Sequence: PDWDSRESWGHESYRGSHKRKRRSHSSTQENRHCKPHHQFKESDCHYLEARSLNERDYRDRRYVDEYRNDYCEGYVPRHYHRDIESGYRIHCSKSSVRSRRSSPKRKRNRHCSSHQSRSKS Predict reactive species Full Name: CDC-like kinase 4 Calculated Molecular Weight: 57 kDa Observed Molecular Weight: 55 kDa GenBank Accession Number: NM_020666 Gene Symbol: CLK4 Gene ID (NCBI): 57396 RRID: AB_3669900 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9HAZ1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924