Product Description
Size: 20ul / 150ul
The TSEN34 (31212-1-AP) by Proteintech is a Polyclonal antibody targeting TSEN34 in WB, IF/ICC, ELISA applications with reactivity to human samples
31212-1-AP targets TSEN34 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: HCT 116 cells, HEK-293 cells, MCF-7 cells, HeLa cells, HEK-293T cells
Positive IF/ICC detected in: MCF-7 cells
Recommended dilution
Western Blot (WB): WB : 1:1000-1:8000
Immunofluorescence (IF)/ICC: IF/ICC : 1:300-1:1200
Background Information
The human tRNA splicing endonuclease consists of a heterotetramer complex formed by the four TSEN proteins, which were identified by homology with their yeast counterparts. TSEN2 and TSEN34 are the catalytic subunits, which form a compound active site, whereas TSEN54 and TSEN15 are structural proteins. (PMID: 27392077)
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35120 Product name: Recombinant human TSEN34 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 52-165 aa of BC020805 Sequence: LMPEEARLLAEIGAVTLVSAPRPDSRHHSLALTSFKRQQEESFQEQSALAAEARETRRQELLEKITEGQAAKKQKLEQASGASSSQEAGSSQAAKEDETSDGQASGEQEEAGPS Predict reactive species
Full Name: tRNA splicing endonuclease 34 homolog (S. cerevisiae)
Calculated Molecular Weight: 34 kDa
Observed Molecular Weight: 34-36 kDa
GenBank Accession Number: BC020805
Gene Symbol: TSEN34
Gene ID (NCBI): 79042
RRID: AB_3669904
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q9BSV6
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924