Iright
BRAND / VENDOR: Proteintech

Proteintech, 31221-1-AP, CDKN2A/P14-ARF Polyclonal antibody

CATALOG NUMBER: 31221-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDKN2A/P14-ARF (31221-1-AP) by Proteintech is a Polyclonal antibody targeting CDKN2A/P14-ARF in WB, IHC, IF/ICC, ELISA applications with reactivity to human samples 31221-1-AP targets CDKN2A/P14-ARF in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HeLa cells Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information CDKN2A locus on chromosome 9p21 encodes two transcripts/proteins INK4A and ARF. INK4A (also referred to as p16INK4A) specially blocks the CDK4 and CDK6 cyclin-dependent kinases that control the phosphorylation status of the retinoblastoma (RB) protein (PMID: 11584300, PMID: 8259215). ARF (known as p14ARF in human and p19ARF in mouse) has been designed as a positive regulator of p53 levels because, through its complexation with Mdm2 (HDM2 in human), it prevents mdm2-mediated cytoplasmic translocation and degradation of p53 (PMID: 9153396). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33340 Product name: Recombinant human ARF protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-132 aa of NM_058195 Sequence: MVRRFLVTLRIRRACGPPRVRVFVVHIPRLTGEWAAPGAPAAVALVLMLLRSQRLGQQPLPRRPGHDDGQRPSGGAAAAPRRGAQLRRPRHSHPTRARRCPGGLPGHAGGAAPGRGAAGRARCLGPSARGPG Predict reactive species Full Name: cyclin-dependent kinase inhibitor 2A Calculated Molecular Weight: 14kd Observed Molecular Weight: 14 kDa, 19 kDa GenBank Accession Number: NM_058195 Gene Symbol: CDKN2A Gene ID (NCBI): 1029 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q8N726 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924