Iright
BRAND / VENDOR: Proteintech

Proteintech, 31277-1-AP, ARFGEF2 Polyclonal antibody

CATALOG NUMBER: 31277-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ARFGEF2 (31277-1-AP) by Proteintech is a Polyclonal antibody targeting ARFGEF2 in WB, IHC, ELISA applications with reactivity to human, mouse samples 31277-1-AP targets ARFGEF2 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue Positive IHC detected in: human stomach cancer tissue, human intrahepatic cholangiocarcinoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. ARFGEF2 is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. ARFGEF2 contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition. Specification Tested Reactivity: human, mouse Cited Reactivity: mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35396 Product name: Recombinant human ARFGEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 211-370 aa of BC050449 Sequence: PIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKEAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGIADDRQSLSSADNLESDAQGHQVAARFSHVL Predict reactive species Full Name: ADP-ribosylation factor guanine nucleotide-exchange factor 2 (brefeldin A-inhibited) Observed Molecular Weight: 202 kDa GenBank Accession Number: BC050449 Gene Symbol: ARFGEF2 Gene ID (NCBI): 10564 RRID: AB_3669925 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9Y6D5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924