Iright
BRAND / VENDOR: Proteintech

Proteintech, 31283-1-AP, FNIP2 Polyclonal antibody

CATALOG NUMBER: 31283-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FNIP2 (31283-1-AP) by Proteintech is a Polyclonal antibody targeting FNIP2 in IP, IHC, ELISA applications with reactivity to Human, Mouse samples 31283-1-AP targets FNIP2 in IP, IHC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive IP detected in: HEK-293 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information Folliculin (FLCN)-interacting proteins 1 and 2 (FNIP1, FNIP2) are homologous binding partners of FLCN, a tumor suppressor for kidney cancer. FNIP2 was found to bind to the C terminus of FLCN and to AMPK, like FNIP1. FNIP2 competes with the activating co-chaperone AHSA1 for binding to HSP90AA1, thereby providing a reciprocal regulatory mechanism for chaperoning of client proteins (PMID: 18403135). Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35014 Product name: Recombinant human FNIP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 740-885 aa of BC166693 Sequence: ERVKACGPSLEASEAADVAQDPQVSRSPFKPGFQENVCCPQNRLSEGDEGESDKGFAEDRGSRNDMAADIAGQLSHAADLGTASHGAGGTGGRRLEATRGLYVKAAEGPVLEPVAPRCVQRGPGLVAGANIPCGDDNKKANFRTEG Predict reactive species Full Name: folliculin interacting protein 2 Observed Molecular Weight: 125 kDa GenBank Accession Number: BC166693 Gene Symbol: FNIP2 Gene ID (NCBI): 57600 RRID: AB_3669929 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: Q9P278 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924