Proteintech, 31299-1-AP, RAPGEF2 Polyclonal antibody

Size: 20ul / 150ul The RAPGEF2 (31299-1-AP) by Proteintech is a Polyclonal antibody targeting RAPGEF2 in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 31299-1-AP targets RAPGEF2 in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, mouse brain tissue Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35288 Product name: Recombinant human RAPGEF2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1255-1400 aa of NM_014247.2 Sequence: GSHDNIQTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASSTGYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP Predict reactive species Full Name: Rap guanine nucleotide exchange factor (GEF) 2 Calculated Molecular Weight: 167kDa Observed Molecular Weight: 200 kDa GenBank Accession Number: NM_014247.2 Gene Symbol: RAPGEF2 Gene ID (NCBI): 9693 RRID: AB_3669936 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y4G8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.