Proteintech, 31322-1-AP, PET100 Polyclonal antibody

Size: 20ul / 150ul The PET100 (31322-1-AP) by Proteintech is a Polyclonal antibody targeting PET100 in IHC, ELISA applications with reactivity to human, mouse samples 31322-1-AP targets PET100 in IHC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive IHC detected in: human colon cancer tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Immunohistochemistry (IHC): IHC : 1:50-1:500 Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34524 Product name: Recombinant human PET100 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-73 aa of NM_001171155 Sequence: MGVKLEIFRMIIYLTFPVAMFWVSNQAEWFEDDVIQRKRELWPPEKLQEIEEFKERLRKRREEKLLRDAQQNS Predict reactive species Full Name: Protein PET100 homolog, mitochondrial Calculated Molecular Weight: 9 kDa GenBank Accession Number: NM_001171155 Gene Symbol: PET100 Gene ID (NCBI): 100131801 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P0DJ07 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.