Iright
BRAND / VENDOR: Proteintech

Proteintech, 31330-1-AP, OSTA Polyclonal antibody

CATALOG NUMBER: 31330-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The OSTA (31330-1-AP) by Proteintech is a Polyclonal antibody targeting OSTA in WB, ELISA applications with reactivity to Human, mouse, rat samples 31330-1-AP targets OSTA in WB, ELISA applications and shows reactivity with Human, mouse, rat samples. Tested Applications Positive WB detected in: mouse small intestine tissue, rat small intestine tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information SLC51A also known as OSTA, belongs to the OST-alpha family. SLC51A is an essential component of the Ost-alpha/Ost-beta complex, a heterodimer that acts as the intestinal basolateral transporter responsible for bile acid export from enterocytes into portal blood (PubMed:16317684). SLC51A is located in basolateral plasma membrane and transported from the endoplasmic reticulum to the plasma membrane upon interacting with SLC51B. SLC51A is expressed with a high expression in kidney and intestine (PMID: 15563450). Mutations in SLC51A are associated with Cholestasis progressive familial intrahepatic 6(PMID: 31863603). Specification Tested Reactivity: Human, mouse, rat Cited Reactivity: mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34517 Product name: Recombinant human SLC51A protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-48 aa of NM_152672 Sequence: MEPGRTQIKLDPRYTADLLEVLKTNYGIPSACFSQPPTAAQLLRALGP Predict reactive species Full Name: organic solute transporter alpha Calculated Molecular Weight: 340 aa, 38 kDa Observed Molecular Weight: 38 kDa GenBank Accession Number: NM_152672 Gene Symbol: SLC51A Gene ID (NCBI): 200931 RRID: AB_3669946 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q86UW1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924