Iright
BRAND / VENDOR: Proteintech

Proteintech, 31348-1-AP, VWA8 Polyclonal antibody

CATALOG NUMBER: 31348-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The VWA8 (31348-1-AP) by Proteintech is a Polyclonal antibody targeting VWA8 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31348-1-AP targets VWA8 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HepG2 cells Positive IHC detected in: mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: U2OS cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information VWA8, also known as KIAA0564, is a mitochondrial matrix-targeted protein having a putative ATPase activity (PMID: 34660594). It has 3 isoforms with the MW of 215, 204, and 117 kDa. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35404 Product name: Recombinant human KIAA0564 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1700-1905 aa of NM_015058.1 Sequence: ELEPQLGSPQQKPKRLRLVVDVSGSMYRFNRMDGRLERTMEAVCMVMEAFENYEEKFQYDIVGHSGDGYNIGLVPMNKIPKDNKQRLEILKTMHAHSQFCMSGDHTLEGTEHAIKEIVKEEADEYFVIVLSDANLSRYGIHPAKFAQILTRDPQVNAFAIFIGSLGDQATRLQRTLPAGRSFVAMDTKDIPQILQQIFTSTMLSSV Predict reactive species Full Name: KIAA0564 Calculated Molecular Weight: 215kDa,1905aa Observed Molecular Weight: 204-215 kDa, 117 kDa GenBank Accession Number: NM_015058.1 Gene Symbol: KIAA0564 Gene ID (NCBI): 23078 RRID: AB_3669955 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity purification UNIPROT ID: A3KMH1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924