Iright
BRAND / VENDOR: Proteintech

Proteintech, 31369-1-AP, HTRA3 Polyclonal antibody

CATALOG NUMBER: 31369-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The HTRA3 (31369-1-AP) by Proteintech is a Polyclonal antibody targeting HTRA3 in WB, ELISA applications with reactivity to human samples 31369-1-AP targets HTRA3 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: SK-N-SH cells, Saos-2 cells, U-87 MG cells Recommended dilution Western Blot (WB): WB : 1:2000-1:16000 Background Information HTRA3 is one of the four members of the HtrA family proteins, with a secreted multidomain and serine protease activity, which plays an important role in cellular stress response, protein homeostasis, and apoptosis. HTRA3 is highly expressed in the decidual cells in the late secretory phase of the menstrual cycle and throughout pregnancy, and in most trophoblast cell types, apart from the invading interstitial trophoblast during the first trimester. HTRA3 and its family members are down-regulated in several cancers and are proposed as tumor suppressors (PMID: 21321049, 22229724). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35448 Product name: Recombinant human HTRA3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 337-453 aa of NM_053044.4 Sequence: ITRFLTEFQDKQIKDWKKRFIGIRMRTITPSLVDELKASNPDFPEVSSGIYVQEVAPNSPSQRGGIQDGDIIVKVNGRPLVDSSELQEAVLTESPLLLEVRRGNDDLLFSIAPEVVM Predict reactive species Full Name: HtrA serine peptidase 3 Calculated Molecular Weight: 49kDa,453aa Observed Molecular Weight: 49 kDa GenBank Accession Number: NM_053044.4 Gene Symbol: HTRA3 Gene ID (NCBI): 94031 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P83110 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924