Proteintech, 31380-1-AP, COG5 Polyclonal antibody

Size: 20ul / 150ul The COG5 (31380-1-AP) by Proteintech is a Polyclonal antibody targeting COG5 in WB, ELISA applications with reactivity to human, mouse, rat samples 31380-1-AP targets COG5 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, LNCaP cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information COG5 (Component Of Oligomeric Golgi Complex 5) is part of an eight-subunit Golgi-resident protein referred to as the conserved oligomeric golgi (COG) complex, which facilitates retrograde Golgi trafficking of vesicles that may include necessary glycosylation enzymes (PMID: 33277529). COG5 knockdown led to marked increases indicative of aberrant glycosylation (PMID: 25331899). The 92- and 87-kDa polypeptides could also be alternatively spliced isoforms of GTC-90 (PMID: 9792665) Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35394 Product name: Recombinant human COG5 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-200 aa of NM_181733.2 Sequence: MGWVGGRRRDSASPPGRSRSAADDINPAPANMEGGGGSVAVAGLGARGSGAAAATVRELLQDGCYSDFLNEDFDVKTYTSQSIHQAVIAEQLAKLAQGISQLDRELHLQVVARHEDLLAQATGIESLEGVLQMMQTRIGALQGAVDRIKAKIVEPYNKIVARTAQLARLQVACDLLRRIIRILNLSKRLQGQLQGGSREI Predict reactive species Full Name: component of oligomeric golgi complex 5 Calculated Molecular Weight: 93kDa，839aa Observed Molecular Weight: 87-93 kDa GenBank Accession Number: NM_181733.2 Gene Symbol: COG5 Gene ID (NCBI): 10466 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UP83 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.