Iright
BRAND / VENDOR: Proteintech

Proteintech, 31426-1-AP, UNC79 Polyclonal antibody

CATALOG NUMBER: 31426-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The UNC79 (31426-1-AP) by Proteintech is a Polyclonal antibody targeting UNC79 in WB, ELISA applications with reactivity to human, mouse, rat samples 31426-1-AP targets UNC79 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse retina tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information UNC79 protein is one of the key auxiliary subunits of the NALCN channel complex. Together with NALCN, FAM155A, and UNC80, it constitutes the NALCN channel body and is essential for maintaining neuronal excitability, motor function, pain sensitivity, and circadian rhythm (PMID: 35387979). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35440 Product name: Recombinant human UNC79 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1740-1860 aa of NM_020818.4 Sequence: PLTLKQKRDLLQKSFALPEMSLDDHPDPGTEGEKPGELMPSSGAKTVLLKVPEDAENPTESEKPDTSAESDTEQNPERKVEEDGAEESEFKIQIVPRQRKQRKIAVSAIQREYLDISFNIL Predict reactive species Full Name: KIAA1409 Calculated Molecular Weight: 295 kDa Observed Molecular Weight: 295 kDa GenBank Accession Number: NM_020818.4 Gene Symbol: UNC79 Gene ID (NCBI): 57578 RRID: AB_3669977 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9P2D8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924