Iright
BRAND / VENDOR: Proteintech

Proteintech, 31431-1-AP, GNA12 Polyclonal antibody

CATALOG NUMBER: 31431-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The GNA12 (31431-1-AP) by Proteintech is a Polyclonal antibody targeting GNA12 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31431-1-AP targets GNA12 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HeLa cells, HepG2 cells Positive IHC detected in: human hepatocellular cancerNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information G protein subunit alpha 12 (GNA12) is a member of the G12 family of G protein alpha subunits. It has 3 isoforms and is expressed in many tissues including lung, testis and placenta. GNA12/13-mediated signaling pathways are involved in a variety of physiological processes including cell growth, cell migration, angiogenesis, platelet activation and apoptosis (PMID: 37426201). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35068 Product name: Recombinant human GNA12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 113-172 aa of BC087537 Sequence: DKLGIPWQYSENEKHGMFLMAFENKAGLPVEPATFQLYVPALSALWRDSGIREAFSRRSE Predict reactive species Full Name: guanine nucleotide binding protein (G protein) alpha 12 Observed Molecular Weight: 37-39 kDa GenBank Accession Number: BC087537 Gene Symbol: GNA12 Gene ID (NCBI): 2768 RRID: AB_3669980 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q03113 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924