Iright
BRAND / VENDOR: Proteintech

Proteintech, 31432-1-AP, ERMN Polyclonal antibody

CATALOG NUMBER: 31432-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ERMN (31432-1-AP) by Proteintech is a Polyclonal antibody targeting ERMN in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 31432-1-AP targets ERMN in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: rat brain tissue, rat cerebellum tissue Positive IF-P detected in: rat brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:5000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information ERMN is associated with cytoskeletal rearrangements and the stability of myelin sheath. A study has shown that ERMN is expressed specifically in oligodendrocytes in the central nervous system (CNS), and is involved in the formation of myelin (PMID: 20934411). The predicted MW of ERMN is 33 KDa, while western blot analyses detected a 45-50 kDa single band protein as a result of phosphorylation modification. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35648 Product name: Recombinant human ERMN protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-257 aa of BC026345 Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSR Predict reactive species Full Name: ermin, ERM-like protein Observed Molecular Weight: 45 kDa GenBank Accession Number: BC026345 Gene Symbol: ERMN Gene ID (NCBI): 57471 RRID: AB_3669981 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TAM6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924