Iright
BRAND / VENDOR: Proteintech

Proteintech, 31435-1-AP, EYA1 Polyclonal antibody

CATALOG NUMBER: 31435-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The EYA1 (31435-1-AP) by Proteintech is a Polyclonal antibody targeting EYA1 in WB, ELISA applications with reactivity to Human, Mouse, Rat samples 31435-1-AP targets EYA1 in WB, ELISA applications and shows reactivity with Human, Mouse, Rat samples. Tested Applications Positive WB detected in: NCCIT cells, mouse kidney tissue, rat kidney tissue Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information The EYA1 (Eyes absent homolog 1) gene is the human homologue of the Drosophila Eya1 gene, which is essential for eye development in that species. There are 4 different isoforms of EYA1 (EYA1A, EYA1B, EYA1C, EYA1D), which are composed of 559 amino acids (AA), 592 AA, 592 AA and 557 AA, respectively. It should be noted that isoforms B and C have the same length; however, they could be considered different variants because of change in amino acidic composition (PMID: 24803398). Specification Tested Reactivity: Human, Mouse, Rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33438 Product name: Recombinant human EYA1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 100-250 aa of BC121799 Sequence: TPSSQTMAAYGQTQFTTGMQQATAYATYPQPGQPYGISSYGALWAGIKTEGGLSQSQSPGQTGFLSYGTSFSTPQPGQAPYSYQMQGSSFTTSSGIYTGNNSLTNSSGFNSSQQDYPSYPSFGQGQYAQYYNSSPYPAHYMTSSNTSPTTP Predict reactive species Full Name: eyes absent homolog 1 (Drosophila) Calculated Molecular Weight: 592 aa, 65 kDa Observed Molecular Weight: 65 kDa GenBank Accession Number: BC121799 Gene Symbol: EYA1 Gene ID (NCBI): 2138 RRID: AB_3669982 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q99502 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924