Iright
BRAND / VENDOR: Proteintech

Proteintech, 31484-1-AP, CCDC76 Polyclonal antibody

CATALOG NUMBER: 31484-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CCDC76 (31484-1-AP) by Proteintech is a Polyclonal antibody targeting CCDC76 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse samples 31484-1-AP targets CCDC76 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293 cells, K-562 cells, LNCaP cells Positive IHC detected in: human placenta tissue, mouse testis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information CCDC76 (coiled‐coil domain‐containing protein 76), also known as the human tRNA Nm4 methyltransferase (hTrmt13) is an uncharacterized human protein containing 481 amino acid residues that shares 27% sequence similarity with yeast Trm13p. The expression of CCDC76 was significantly associated with patient survival in breast carcinoma and liver and renal cancer patients (PMID: 34850409). Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34110 Product name: Recombinant human CCDC76 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 132-481 aa of BC075811 Sequence: GLNSTLKDHIMSHPALHDALNDPKNGDSATKHLKQQASILGNIENLKLLGPRRCFVEFGAGKGKLSHWVDIALKDAEKVHFILVEKVTTRFKVDGKHRKKNSVFERLQIDIQHLCLNKIPVLREEKLPVVGIGKHLCGMATDLALRCLVETYAASFEERNEEPLAKRIKNDKTEKEIYTLAKEGNEKNVPEKWNPVAGIVIALCCHHRCDWRHYVGKEYFRALGLGAVEFHYFQRMSSWATCGMRKTSLETSNSTTKRQDNQNDDSEEHDDGGYRITDDGADCLPGLLSVEEKKKIGHLCKLLIDQGRIQYLQQKGFSPALQYYTDPLVSLENVLLTALPNHSSSPETTA Predict reactive species Full Name: coiled-coil domain containing 76 Observed Molecular Weight: 54 kDa GenBank Accession Number: BC075811 Gene Symbol: CCDC76 Gene ID (NCBI): 54482 RRID: AB_3670001 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NUP7 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924