Iright
BRAND / VENDOR: Proteintech

Proteintech, 31495-1-AP, human IgG3 Polyclonal antibody

CATALOG NUMBER: 31495-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The human IgG3 (31495-1-AP) by Proteintech is a Polyclonal antibody targeting human IgG3 in WB, IHC, ELISA applications with reactivity to human, pig samples 31495-1-AP targets human IgG3 in WB, IHC, ELISA applications and shows reactivity with human, pig samples. Tested Applications Positive WB detected in: pig spleen tissue, pig tonsil tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunohistochemistry (IHC): IHC : 1:5000-1:20000 Specification Tested Reactivity: human, pig Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35740 Product name: Recombinant human IGHG3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 239-312 aa of NG_001019.6 Sequence: LHQDWLNGKEYKCKVSNKALPAPIEKTISKTKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWE Predict reactive species Full Name: immunoglobulin heavy constant gamma 3 (G3m marker) Calculated Molecular Weight: 49kDa,446aa Observed Molecular Weight: 50-55 kDa GenBank Accession Number: NG_001019.6 Gene Symbol: IGHG3 Gene ID (NCBI): 3502 RRID: AB_3670007 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P01860 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924