Iright
BRAND / VENDOR: Proteintech

Proteintech, 31496-1-AP, ZNF148 Polyclonal antibody

CATALOG NUMBER: 31496-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The ZNF148 (31496-1-AP) by Proteintech is a Polyclonal antibody targeting ZNF148 in WB, ELISA applications with reactivity to human samples 31496-1-AP targets ZNF148 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, MCF-7 cells, HeLa cells, T-47D cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The Kruppel-like zinc finger protein 148 (ZNF148), also known as β enolase repressor factor 1 (BERF1, ZBP-89, and BFCOL1), encoded by this gene is a member of the Kruppel family of zinc finger DNA binding proteins. ZNF148 participates in the regulation of cell proliferation and death, and is expressed at lower levels in mammalian somatic cells, and highly expressed in tumor cells. Previous studies show that there was a significant correlation between ZNF148 expression and the invasion and metastasis of colorectal tumors. ZNF148 has two alternative splicing isoforms, which are ZNF148FL and ZNF148ΔN. ZNF148FL contains a complete 794 amino acids, ZNF148ΔN lacks the amino-terminal 129 amino acids, and the mechanisms involved in the generation of these two splicing isoforms are not yet clear (PMID: 30463804). Thus, ZNF148 can be observed to have two molecular weights near 103 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35742 Product name: Recombinant human ZNF148 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 611-794 aa of BC035591 Sequence: QALDRTSQNDAYLNSPSLNFVTDNQTLPNQPAFSSIDKQVYATMPINSFRSGMNSPLRTTPDKSHFGLIVGDSQHSFPFSGDETNHASATSTQDFLDQVTSQKKAEAQPVHQAYQMSSFEQPFRAPYHGSRAGIATQFSTANGQVNLRGPGTSAEFSEFPLVNVNDNRAGMTSSPDATTGQTFG Predict reactive species Full Name: zinc finger protein 148 Observed Molecular Weight: 103 kDa GenBank Accession Number: BC035591 Gene Symbol: ZNF148 Gene ID (NCBI): 7707 RRID: AB_3670008 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9UQR1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924