Iright
BRAND / VENDOR: Proteintech

Proteintech, 31526-1-AP, CDC42BPB Polyclonal antibody

CATALOG NUMBER: 31526-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CDC42BPB (31526-1-AP) by Proteintech is a Polyclonal antibody targeting CDC42BPB in WB, ELISA applications with reactivity to Human samples 31526-1-AP targets CDC42BPB in WB, ELISA applications and shows reactivity with Human samples. Tested Applications Positive WB detected in: HEK-293T cells, HeLa cells, U-251 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Background Information CDC42BPB is a serine/threonine protein kinase and codes for MRCKβ (myotonic dystrophy-related Cdc42-binding kinase beta), a regulator of cell cytoskeletal reorganization and cell migration. CDC42BPB shows expression in the granule cell layer of the lateral adult cerebellum, which has been associated with cognitive functions, and has recently been associated with neurodevelopmental disorders including ASD (autism spectrum disorder). (PMID: 35942939) Specification Tested Reactivity: Human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35745 Product name: Recombinant human CDC42BPB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1530-1711 aa of NM_006035.3 Sequence: SGAVLNVPDTSDNSKKQMLRTRSKRRFVFKVPEEERLQQRREMLRDPELRSKMISNPTNFNHVAHMGPGDGMQVLMDLPLSAVPPSQEERPGPAPTNLARQPPSRNKPYISWPSSGGSEPSVTVPLRSMSDPDQDFDKEPDSDSTKHSTPSNSSNPSGPPSPNSPHRSQLPLEGLEQPACDT Predict reactive species Full Name: CDC42 binding protein kinase beta (DMPK-like) Calculated Molecular Weight: 194 kDa Observed Molecular Weight: 194 kDa GenBank Accession Number: NM_006035.3 Gene Symbol: CDC42BPB Gene ID (NCBI): 9578 RRID: AB_3670021 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y5S2 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924