Proteintech, 31527-1-AP, RBP2 Polyclonal antibody

Size: 20ul / 150ul The RBP2 (31527-1-AP) by Proteintech is a Polyclonal antibody targeting RBP2 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples 31527-1-AP targets RBP2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse small intestine tissue, rat small intestine tissue Positive IHC detected in: human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Background Information Retinol-binding protein 2 (RBP2) also known as CRBP2, CRBP-II, is an abundant 134-residue protein confined largely to the small intestinal enterocyte. It is thought to participate in the uptake and/or intracellular metabolism of vitamin A(PMID: 3029082). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35801 Product name: Recombinant human RBP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 31-134 aa of NM_004164.2 Sequence: RKIAVRLTQTKVIDQDGDNFKTKTTSTFRNYDVDFTVGVEFDEYTKSLDNRHVKALVTWEGDVLVCVQKGEKENRGWKQWIEGDKLYLELTCGDQVCRQVFKKK Predict reactive species Full Name: retinol binding protein 2, cellular Calculated Molecular Weight: 16 kDa Observed Molecular Weight: 16 kDa GenBank Accession Number: NM_004164.2 Gene Symbol: RBP2 Gene ID (NCBI): 5948 RRID: AB_3670022 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P50120 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.