Iright
BRAND / VENDOR: Proteintech

Proteintech, 31532-1-AP, PPP1R21 Polyclonal antibody

CATALOG NUMBER: 31532-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PPP1R21 (31532-1-AP) by Proteintech is a Polyclonal antibody targeting PPP1R21 in WB, IHC, IF-P, ELISA applications with reactivity to human, mouse samples 31532-1-AP targets PPP1R21 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: MCF-7 cells, THP-1 cells Positive IHC detected in: human stomach cancer tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: mouse cerebellum tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:500-1:2000 Immunofluorescence (IF)-P: IF-P : 1:200-1:800 Background Information PPP1R21, also known as KLRAQ1, CCDC12 and FERRY2, encodes a conserved protein involved in endosomal maturation. It has many isoforms and may play a role in the endosomal sorting process or in the endosome maturation pathway. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35449 Product name: Recombinant human KLRAQ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-236 aa of BC111059 Sequence: MASAELQGKYQKLAQEYSKLRAQNQVLKKGVVDEQANSAALKEQLKMKDQSLRKLQQEMDSLTFRNLQLAKRVELLQDELALSEPRGKKNKKSGESSSQLSQEQKSVFDEDLQKKIEENERLHIQFFEADEQHKHVEAELRSRLATLETEAAQHQAVVDGLTRKYMETIEKLQNDKAKLEVKSQTLEKEAKECRLRTEECQLQLKTLHEDLSGRLEESLSIINEKVPFNDTKYSQY Predict reactive species Full Name: KLRAQ motif containing 1 Observed Molecular Weight: 88 kDa GenBank Accession Number: BC111059 Gene Symbol: KLRAQ1 Gene ID (NCBI): 129285 RRID: AB_3670023 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q6ZMI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924