Proteintech, 31561-1-AP, MIC10 Polyclonal antibody

Size: 20ul / 150ul The MIC10 (31561-1-AP) by Proteintech is a Polyclonal antibody targeting MIC10 in WB, IF/ICC, ELISA applications with reactivity to Human, Mouse samples 31561-1-AP targets MIC10 in WB, IF/ICC, ELISA applications and shows reactivity with Human, Mouse samples. Tested Applications Positive WB detected in: HCT 116 cells, HEK-293 cells, L02 cells, mouse heart tissue Positive IF/ICC detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information MIC10, also known as C1orf151, MICOS10, and MINOS1, belongs to the  MICOS complex subunit Mic10 family. MIC10 is a component of the MICOS complex, which is a large protein complex located in the inner membrane of mitochondria. MIC10 plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. MIC10 is also functionally connected to the F1Fo-ATP synthase (PMID: 22114354, PMID: 28315355). Specification Tested Reactivity: Human, Mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34301 Product name: Recombinant human MIC10 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2-78 aa of NM_001032363 Sequence: SESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQ Predict reactive species Full Name: chromosome 1 open reading frame 151 Calculated Molecular Weight: 9 kDa Observed Molecular Weight: 10 kDa GenBank Accession Number: NM_001032363 Gene Symbol: C1orf151 Gene ID (NCBI): 440574 RRID: AB_3670036 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q5TGZ0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.