Proteintech, 31569-1-AP, AIF1L Polyclonal antibody

Size: 20ul / 150ul The AIF1L (31569-1-AP) by Proteintech is a Polyclonal antibody targeting AIF1L in WB, IF-P, ELISA applications with reactivity to human, mouse, rat samples 31569-1-AP targets AIF1L in WB, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: HEK-293 cells, MCF-7 cells, mouse kidney tissue, rat kidney tissue Positive IF-P detected in: mouse kidney tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information AIF1L is a homolog to the allograft inflammatory factor 1 (AIF1 or IBA1), sharing up to 60% sequence homology. Previous work could demonstrate that AIF1L and AIF1 show actin bundling and cross-linking function, co-localization, and-sedimentation with F-actin. More recently, increased expression levels for AIF1L were reported in cases of breast cancer and functionally related to increased proliferation rates via upregulation of cyclin D1. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36216 Product name: Recombinant human AIF1L protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-69 aa of BC021253 Sequence: MSGELSNRFQGGKAFGLLKARQERRLAEINREFLCDQKYSDEENLPEKLTAFKEKYMEFDLNNEGEIDL Predict reactive species Full Name: allograft inflammatory factor 1-like Observed Molecular Weight: 17 kDa GenBank Accession Number: BC021253 Gene Symbol: AIF1L Gene ID (NCBI): 83543 RRID: AB_3670038 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9BQI0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.