Iright
BRAND / VENDOR: Proteintech

Proteintech, 31572-1-AP, WHAMM Polyclonal antibody

CATALOG NUMBER: 31572-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The WHAMM (31572-1-AP) by Proteintech is a Polyclonal antibody targeting WHAMM in WB, ELISA applications with reactivity to human samples 31572-1-AP targets WHAMM in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: Daudi cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information WHAMM (WASP homolog associated with actin, golgi membranes and microtubules), also known as WHDC1. It is expected to be located in the cytoplasm, which is enriched in brain, lung, heart, colon and kidney. WHAMM is involved in Golgi membrane association, microtubule binding, and actin nucleation as a nucleation-promoting factor, which activates the actin-related protein 2/3 complex (the Arp2/ 3 complex) (PMID: 23160625). It is reported that the nucleation-promoting factor (NPF) WHAMM recruits and activates the Arp2/3 complex for actin assembly at sites of autophagosome formation on the ER (PMID: 26291929). The molecular weight of WHAMM is 90 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36160 Product name: Recombinant human WHAMM protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 660-809 aa of BC167774 Sequence: RALSSSSQAATHQNLGFRAPVKDDQPRPLVCESPAERPRDSLESFSCPGSMDEVLASLRHGRAPLRKVEVPAVRPPHASINEHILAAIRQGVKLKKVHPDLGPNPSSKPTSNRRTSDLERSIKAALQRIKRVSADSEEDSDEQDPGQWDG Predict reactive species Full Name: WAS protein homolog associated with actin, golgi membranes and microtubules Observed Molecular Weight: 90-100 kDa GenBank Accession Number: BC167774 Gene Symbol: WHAMM Gene ID (NCBI): 123720 RRID: AB_3670039 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8TF30 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924