Proteintech, 31588-1-AP, CNTD2 Polyclonal antibody

Size: 20ul / 150ul The CNTD2 (31588-1-AP) by Proteintech is a Polyclonal antibody targeting CNTD2 in WB, ELISA applications with reactivity to human samples 31588-1-AP targets CNTD2 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information CNTD2, also known as Cyclin N-terminal domain containing 2 or CCNP, is a protein that has been implicated in cancer cell proliferation and migration, particularly in colon and lung cancers . It is an atypical cyclin that contains a cyclin box domain, which is a characteristic feature of cyclin-dependent kinase (CDK) binding partners. CNTD2 is considered an atypical cyclin due to its structural specificities, which were revealed through the human genome sequence project (PMID: 30087414). The apparent molecular mass measured by SDS-PAGE is 25 kDa. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36380 Product name: Recombinant human CNTD2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-100 aa of NM_024877 Sequence: MLVRGRDQGSGSRLGPIVRRWAPRPSPLQSLAASLDAEPSSAAVPDGFPAGPTVSPRRLARPPGLEEALSALGLQGEREYAGDIFAEVMVCRVLPLRALP Predict reactive species Full Name: cyclin N-terminal domain containing 2 Calculated Molecular Weight: 33kDa Observed Molecular Weight: 25 kDa GenBank Accession Number: NM_024877 Gene Symbol: CNTD2 Gene ID (NCBI): 79935 RRID: AB_3670047 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H8S5 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.