Proteintech, 31621-1-AP, CD209 Polyclonal antibody

Size: 20ul / 150ul The CD209 (31621-1-AP) by Proteintech is a Polyclonal antibody targeting CD209 in WB, IHC, IF-P, ELISA applications with reactivity to human samples 31621-1-AP targets CD209 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: human placenta tissue Positive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF-P detected in: human tonsillitis tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Immunohistochemistry (IHC): IHC : 1:1000-1:4000 Immunofluorescence (IF)-P: IF-P : 1:50-1:500 Background Information CD209 (DC-SIGN, CLEC4L) is a C-type lectin receptor that is involved in the innate immune system and recognizes numerous evolutionarily divergent pathogens, including bacteria, viruses, and parasites. CD209 is preferentially expressed on dendritic cells (DCs). It mediates transient adhesion of DCs with T cells. It has been reported that CD209 plays a role in capture and transmission of HIV from DC to T cells (PMID: 10721995). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0062 Product name: Recombinant Human CD209 protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec Tag: N-6*his Domain: 59-404 aa of BC110615 Sequence: QVSKVPSSISQEQSRQDAIYQNLTQLKAAVGELSEKSKLQEIYQELTQLKAAVGELPEKSKLQEIYQELTRLKAAVGELPEKSKLQEIYQELTWLKAAVGELPEKSKMQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTRLKAAVGELPEKSKQQEIYQELTQLKAAVERLCHPCPWEWTFFQGNCYFMSNSQRNWHDSITACKEVGAQLVVIKSAEEQNFLQLQSSRSNRFTWMGLSDLNQEGTWQWVDGSPLLPSFKQYWNRGEPNNVGEEDCAEFSGNGWNDDKCNLAKFWICKKSAASCSRDEEQFLSPAPATPNPPPA Predict reactive species Full Name: CD209 molecule Calculated Molecular Weight: 404 aa, 45.7 kDa Observed Molecular Weight: 45 kDa GenBank Accession Number: BC110615 Gene Symbol: CD209 Gene ID (NCBI): 30835 RRID: AB_3670051 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9NNX6 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.