Proteintech, 31628-1-AP, VLGR1 Polyclonal antibody

Size: 20ul / 150ul The VLGR1 (31628-1-AP) by Proteintech is a Polyclonal antibody targeting VLGR1 in WB, IHC, IP, ELISA applications with reactivity to human, mouse samples 31628-1-AP targets VLGR1 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: HEK-293T cells, SH-SY5Y cells Positive IP detected in: SH-SY5Y cells Positive IHC detected in: human lung tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate Immunohistochemistry (IHC): IHC : 1:50-1:500 Background Information VLGR1 (very large G protein-coupled receptor-1), also known as ADGRV1, GPR98, and MASS, has a molecular weight of up to 700 kDa, making it the largest member of the 33 adhesive G protein-coupled receptors (ADGRs), a unique subfamily of the GPCR superfamily. The full-length VLGR1 encompasses ∼6300 amino acids and thus is difficult to analyze by electrophoresis. Vlgr1 is a core component of ankle-link complex in inner ear hair cells. Knock-out and mutation mouse models show that loss of Vlgr1 function leads to abnormal stereociliary development and hearing loss, indicating crucial roles of Vlgr1 in hearing transduction or auditory system development (PMID: 23180093). Western blot analysis detected VLGR1a isoform at an apparent molecular mass of 217 kDa . Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34635 Product name: Recombinant human ADGRV1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 2269-2812 aa of NM_032119 Sequence: ESIIVSLVYTEGGSRILPSSDTVRVNILANDNVAGIVSFQTASRSVIGHEGEILQFHVIRTFPGRGNVTVNWKIIGQNLELNFANFSGQLFFPEGSLNTTLFVHLLDDNIPEEKEVYQVILYDVRTQGVPPAGIALLDAQGYAA Predict reactive species Full Name: G protein-coupled receptor 98 Calculated Molecular Weight: 693 kDa Observed Molecular Weight: 217 kDa GenBank Accession Number: NM_032119 Gene Symbol: GPR98 Gene ID (NCBI): 84059 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8WXG9 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.