Iright
BRAND / VENDOR: Proteintech

Proteintech, 31641-1-AP, FGR Polyclonal antibody

CATALOG NUMBER: 31641-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FGR (31641-1-AP) by Proteintech is a Polyclonal antibody targeting FGR in WB, IF/ICC, ELISA applications with reactivity to human samples 31641-1-AP targets FGR in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells, Raji cells Positive IF/ICC detected in: Raji cells Recommended dilution Western Blot (WB): WB : 1:2000-1:10000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information FGR (Tyrosine-protein kinase Fgr), a member of the Src family of tyrosine kinases, is highly expressed in many cancers and can regulate mitochondrial oxidative phosphorylation (PMID: 37475042). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34944 Product name: Recombinant human FGR protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-90 aa of NM_005248 Sequence: MGCVFCKKLEPVATAKEDAGLEGDFRSYGAADHYGPDPTKARPASSFAHIPNYSNFSSQAINPGFLDSGTIRGVSGIGVTLFIALYDYEA Predict reactive species Full Name: Gardner-Rasheed feline sarcoma viral (v-fgr) oncogene homolog Calculated Molecular Weight: 59 kDa Observed Molecular Weight: 59 kDa GenBank Accession Number: NM_005248 Gene Symbol: FGR Gene ID (NCBI): 2268 RRID: AB_3670061 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P09769 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924