Iright
BRAND / VENDOR: Proteintech

Proteintech, 31671-1-AP, PCDHA1 Polyclonal antibody

CATALOG NUMBER: 31671-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The PCDHA1 (31671-1-AP) by Proteintech is a Polyclonal antibody targeting PCDHA1 in WB, ELISA applications with reactivity to human, mouse samples 31671-1-AP targets PCDHA1 in WB, ELISA applications and shows reactivity with human, mouse samples. Tested Applications Positive WB detected in: SH-SY5Y cells, U2OS cells, human brain tissue, mouse brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information Protocadherin alpha-1 (PCDHA1) is a potential calcium-dependent cell adhesion protein. May be involved in the establishment and maintenance of specific neuronal connections in the brain. Specification Tested Reactivity: human, mouse Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36313 Product name: Recombinant human PCDHA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 130-310 aa of BC166697 Sequence: PPVFRGREQIIFIPESRLLNSRFPIEGAADADIGANALLTYTLSPSDYFSLDVEASDELSKSLWLELRKYLDREETPELHLLLTATDGGKPELQGTVELLITVLDVNDNAPLFDQAVYRVHLLETTANGTLVTTLNASDADEGVNGEVVFSFDSGISRDIQEKFKVDSSSGEIRLIDKLDY Predict reactive species Full Name: protocadherin alpha 1 Observed Molecular Weight: 102 kDa GenBank Accession Number: BC166697 Gene Symbol: PCDHA1 Gene ID (NCBI): 56147 RRID: AB_3670070 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9Y5I3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924