Iright
BRAND / VENDOR: Proteintech

Proteintech, 31683-1-AP, CIZ1 Polyclonal antibody

CATALOG NUMBER: 31683-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The CIZ1 (31683-1-AP) by Proteintech is a Polyclonal antibody targeting CIZ1 in WB, ELISA applications with reactivity to human samples 31683-1-AP targets CIZ1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: A549 cells, HeLa cells, Jurkat cells, K-562 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information CIZ1, also known as LSFR1 and ZNF356, is a nuclear protein and the binding partner of p21. The full-length CIZ1 consists of 842 amino acid (aa) residues and contains two glutamine-rich domains, three C2H2-type zinc finger motifs, one acidic domain, and one MH3 domain (PMID: 10529385). Dysregulated or point mutated CIZ1 has been implicated in neurodegenerative, autoimmune and cancer diseases. Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35418 Product name: Recombinant human CIZ1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 126-350 aa of BC021163 Sequence: FFPQATRQSLLGPPPVGVPMNPSQFNLSGRNPQKQARTSSSTTPNRKDSSSQTMPVEDKSDPPEGSEEAAEPRMDTPEDQDLPPCPEDIAKEKRTPAPEPEPCEASELPAKRLRSSEEPTEKEPPGQLQVKAQPQARMTVPKQTQTPDLLPEALEAQVLPRFQPRVLQVQAQVQSQTQPRIPSTDTQVQPKLQKQAQTQTSPEHLVLQQKQVQPQLQQEAEPQKQ Predict reactive species Full Name: CDKN1A interacting zinc finger protein 1 Observed Molecular Weight: 140 kDa GenBank Accession Number: BC021163 Gene Symbol: CIZ1 Gene ID (NCBI): 25792 RRID: AB_3670077 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9ULV3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924