Iright
BRAND / VENDOR: Proteintech

Proteintech, 31694-1-AP, FAM210A Polyclonal antibody

CATALOG NUMBER: 31694-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The FAM210A (31694-1-AP) by Proteintech is a Polyclonal antibody targeting FAM210A in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31694-1-AP targets FAM210A in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse adipose tissue, mouse heart tissue, rat adipose tissue Positive IHC detected in: human ovary cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: A431 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:8000 Immunohistochemistry (IHC): IHC : 1:400-1:1600 Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500 Background Information FAM210A also known as C18orf19, is a determinant of bone and muscle structure and strength. FAM210A is required for cold-induced mitochondrial cristae remodeling, adaptive thermogenic activity, and brown adipose tissue characteristics(PMID: 37816711). FAM210A is localized to mitochondria and cytoplasm of muscle cells and myotubes(PMID: 29618611). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36161 Product name: Recombinant human C18orf19 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 157-272 aa of NM_001098801 Sequence: LKGVNVVPFLELIGLPDSVVSILKNSQSGNALTAYALFKIATPARYTVTLGGTSVTVKYLRSHGYMSTPPPVKEYLQDRMEETKELITEKMEETKDRLTEKLQETKEKVSFKKKVE Predict reactive species Full Name: chromosome 18 open reading frame 19 Calculated Molecular Weight: 30kDa Observed Molecular Weight: 20 kDa GenBank Accession Number: NM_001098801 Gene Symbol: C18orf19 Gene ID (NCBI): 125228 RRID: AB_3670081 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96ND0 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924