Iright
BRAND / VENDOR: Proteintech

Proteintech, 31713-1-AP, SPTBN4 Polyclonal antibody

CATALOG NUMBER: 31713-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SPTBN4 (31713-1-AP) by Proteintech is a Polyclonal antibody targeting SPTBN4 in WB, IHC, IF/ICC, ELISA applications with reactivity to human, mouse, rat samples 31713-1-AP targets SPTBN4 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, mouse cerebellum tissue, rat brain tissue Positive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0 Positive IF/ICC detected in: SH-SY5Y cells Recommended dilution Western Blot (WB): WB : 1:500-1:1000 Immunohistochemistry (IHC): IHC : 1:50-1:500 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information SPTBN4 also known as beta-IV spectrin, encodes a nonerythrocytic member of the beta-spectrin protein family that is expressed in the brain, peripheral nervous system, pancreas, and skeletal muscle. Spectrins are rod-shaped proteins that were originally identified as part of the lattice-like cytoskeleton under the erythrocyte membrane(PMID: 11086001). Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36430 Product name: Recombinant human SPTBN4 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 2100-2300 aa of NM_020971 Sequence: WEERFSSLRRLTTIEKIKAEQSKQPPTPLLGRKFFGDPTELAAKAAPLLRPGGYERGLEPLARRASDTLSAEVRTRVGYVRQELKPERLQPRIDRLPEIPGRVEPAALPAAPEDAAETPATPAAAEQVRPRPERQESADRAEELPRRRRPERQESVDQSEEAARRRRPERQESAEHEAAHSLTLGRYEQMERRRERRERRL Predict reactive species Full Name: spectrin, beta, non-erythrocytic 4 Calculated Molecular Weight: 288kDa Observed Molecular Weight: 250, 140 kDa GenBank Accession Number: NM_020971 Gene Symbol: SPTBN4 Gene ID (NCBI): 57731 RRID: AB_3670092 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q9H254 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924