Product Description
Size: 20ul / 150ul
The PDE4B (31730-1-AP) by Proteintech is a Polyclonal antibody targeting PDE4B in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples
31730-1-AP targets PDE4B in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Applications
Positive WB detected in: HeLa cells, mouse brain tissue, rat brain tissue
Positive IHC detected in: mouse brain tissue, rat brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0
Recommended dilution
Western Blot (WB): WB : 1:1000-1:6000
Immunohistochemistry (IHC): IHC : 1:200-1:800
Background Information
PDE4B, also known as DPDE4, is a member of the PDE family of type IV cAMP-specific cyclic nucleotides. PDE4B regulates the cellular concentration of cyclic nucleotides and thus plays a role in signal transduction of inflammatory factors. Among all subtypes of PDE4, PDE4B is closely associated with cancer and has a major contribution to the role in hematological malignancies. PDE4B is distributed in multiple tissues, especially myeloid cells (PMID: 35899614, PMID: 36278172).
Specification
Tested Reactivity: human, mouse, rat
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag35552 Product name: Recombinant human PDE4B protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 651-736 aa of BC105040 Sequence: WYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT Predict reactive species
Full Name: phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)
Calculated Molecular Weight: 736 aa, 83 kDa
Observed Molecular Weight: 83 kDa
GenBank Accession Number: BC105040
Gene Symbol: PDE4B
Gene ID (NCBI): 5142
RRID: AB_3670101
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q07343
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924