Iright
BRAND / VENDOR: Proteintech

Proteintech, 31742-1-AP, KCNJ9 Polyclonal antibody

CATALOG NUMBER: 31742-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The KCNJ9 (31742-1-AP) by Proteintech is a Polyclonal antibody targeting KCNJ9 in WB, ELISA applications with reactivity to human, mouse, rat samples 31742-1-AP targets KCNJ9 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information KCNJ9, also known as GIRK3 (G protein-activated inwardly rectifying potassium channel 3), is a crucial subunit that forms inwardly rectifying potassium channels. These channels are primarily activated by inhibitory G proteins (Gi/o) downstream of various G protein-coupled receptors (GPCRs), such as those for neurotransmitters like GABA, acetylcholine, and adenosine. Upon activation, KCNJ9 facilitates potassium efflux, leading to membrane hyperpolarization and a reduction in neuronal excitability. It is widely expressed in the brain, where it plays a key role in regulating synaptic transmission and neuronal circuits, influencing processes ranging from pain perception to reward and motivation. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag35873 Product name: Recombinant human KCNJ9 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 157-395 aa of BC167777 Sequence: MFVKISQPNKRAATLVFSSHAVVSLRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLFLVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLWGHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEKVEEEGAGEGAGGEAGADKEQNGCLPPPESESKV Predict reactive species Full Name: potassium inwardly-rectifying channel, subfamily J, member 9 Observed Molecular Weight: 38-44 kDa GenBank Accession Number: BC167777 Gene Symbol: KCNJ9 Gene ID (NCBI): 3765 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q92806 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924