Product Description
Size: 20ul / 150ul
The KBTBD6 (31743-1-AP) by Proteintech is a Polyclonal antibody targeting KBTBD6 in WB, ELISA applications with reactivity to human samples
31743-1-AP targets KBTBD6 in WB, ELISA applications and shows reactivity with human samples.
Tested Applications
Positive WB detected in: Saos-2 cells, TT cells, U-251 cells
Recommended dilution
Western Blot (WB): WB : 1:500-1:2000
Background Information
KBTBD6 (Kelch repeat and BTB domain-containing protein 6) is involved in proteasome-mediated ubiquitin-dependent protein catabolic process; protein K48-linked ubiquitination; and Rac protein signal transduction regulation.
Specification
Tested Reactivity: human
Host / Isotype: Rabbit / IgG
Class: Polyclonal
Type: Antibody
Immunogen: CatNo: Ag36046 Product name: Recombinant human KBTBD6 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 625-674 aa of BC000560 Sequence: PGQSFLTEEEEIPSESSTEWDLGGFSEPDSESGSSSSLSDDDFWVRVAPQ Predict reactive species
Full Name: kelch repeat and BTB (POZ) domain containing 6
Observed Molecular Weight: 76 kDa
GenBank Accession Number: BC000560
Gene Symbol: KBTBD6
Gene ID (NCBI): 89890
RRID: AB_3670103
Conjugate: Unconjugated
Form: Liquid
Purification Method: Antigen affinity Purification
UNIPROT ID: Q86V97
Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.
Order Guidelines
1. Price & Stock Available on Request. Click to send email to: service@iright.com
2. Please DO NOT make payment before confirmation.
3. Minimum order value of $1,000 USD required.
Collaboration
Tony Tang
Email: Tony.Tang@iright.com
Mobile/WhatsApp/Wechat: +86-17717886924