Iright
BRAND / VENDOR: Proteintech

Proteintech, 31765-1-AP, TFPI Polyclonal antibody

CATALOG NUMBER: 31765-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The TFPI (31765-1-AP) by Proteintech is a Polyclonal antibody targeting TFPI in WB, IF/ICC, ELISA applications with reactivity to human samples 31765-1-AP targets TFPI in WB, IF/ICC, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HepG2 cells Positive IF/ICC detected in: HeLa cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800 Background Information Tissue factor pathway inhibitor (TFPI) is an anticoagulant protein produced primarily by the endothelium and megakaryocytes and alternative mRNA splicing generates two main forms, TFPIα and TFPIβ (PMID: 26149025, PMID: 16246254). TFPIα is a soluble form of TFPI. It is a ~46 kDa glycoprotein and consists of an acidic N-terminal regionfollowed by three tandem, Kunitz-type protease inhibitor domains and a basic C-terminal region. Based on protein mass, TFPIβ (28 kDa) is considerably smaller than TFPIα (36 kDa), but both migrate with the same apparent molecular mass (46 kDa) on sodium dodecylsulfatepolyacrylamide gel electrophoresis (SDS-PAGE), suggesting a difference in post-translational modifications (PMID: 16246254). TFPI associated with LDLis 34 kDa and lacks a substantial portion of the carboxy terminus including at least a portion of the third Kunitz domain. TFPI associated with HDL is 41 kDa and is in part a mixed disulphide complex between TFPI and apolipoprotein All (PMID: 8979119). TFPI exerts its anticoagulant effects by inhibiting TF-FVIIa in a manner that is dependent on its inhibition of factor Xa (FXa) (PMID: 2927510). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Eg0855 Product name: Recombinant Human TFPI protein (His Tag) Source: mammalian cells -derived, pHZ-KIsec-C-6*HIS Tag: C-10*His Domain: 29-282 aa of NM_006287.6 Sequence: DSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIFTRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFCFLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNICEDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGLCRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRISKGGLIK Predict reactive species Full Name: tissue factor pathway inhibitor (lipoprotein-associated coagulation inhibitor) Calculated Molecular Weight: 35 kDa Observed Molecular Weight: 35-40 kDa GenBank Accession Number: NM_006287.6 Gene Symbol: TFPI Gene ID (NCBI): 7035 RRID: AB_3670106 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: P10646-1 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924