Iright
BRAND / VENDOR: Proteintech

Proteintech, 31777-1-AP, DRAM Polyclonal antibody

CATALOG NUMBER: 31777-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The DRAM (31777-1-AP) by Proteintech is a Polyclonal antibody targeting DRAM in WB, ELISA applications with reactivity to human samples 31777-1-AP targets DRAM in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HCT 116 cells, HeLa cells, HepG2 cells Recommended dilution Western Blot (WB): WB : 1:500-1:3000 Background Information Damage-regulated autophagy modulator (DRAM) is a lysosomal membrane protein of autophagy that enriches in lung tissue and plays a central role in p53/TP53-mediated apoptosis (PMID: 16839881), which increased autophagy flux by promoting lysosomal acidification and protease activation (PMID: 23696801). It has 238 amino acids and six hydrophobic transmembrane regions. Reports show DRAM to be downregulated in squamous cancers, indicating a selective pressure to lose DRAM during tumor development (PMID: 17102582). Overexpression of DRAM1 can promote mitophagy and enhance mitochondrial function (PMID: 31204316). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag33711 Product name: Recombinant human DRAM protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 30-90 aa of BC018435 Sequence: AVLSGHVNPFLPYISDTGTTPPESGIFGFMINFSAFLGAATMYTRYKIVQKQNQTCYFSTP Predict reactive species Full Name: damage-regulated autophagy modulator Calculated Molecular Weight: 26 kDa Observed Molecular Weight: 33 kDa GenBank Accession Number: BC018435 Gene Symbol: DRAM Gene ID (NCBI): 55332 RRID: AB_3670110 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N682 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924