Iright
BRAND / VENDOR: Proteintech

Proteintech, 31834-1-AP, SYTL1 Polyclonal antibody

CATALOG NUMBER: 31834-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The SYTL1 (31834-1-AP) by Proteintech is a Polyclonal antibody targeting SYTL1 in WB, ELISA applications with reactivity to human samples 31834-1-AP targets SYTL1 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HL-60 cells Recommended dilution Western Blot (WB): WB : 1:1000-1:6000 Background Information Synaptotagmin-like protein 1 (SYTL1, also known as SLP1 and Exophilin-7) is a protein that plays a crucial role in vesicle trafficking and exocytosis. SYTL1 differentially regulates the secretion of prostate-specific antigen and prostatic-specific acid phosphatase (PMID: 36653850). The expression level of SYTL1 is also associated with bladder cancer progression (PMID: 36107384). Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag27391 Product name: Recombinant human SYTL1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 106-326 aa of BC015764 Sequence: MRRKKSTRGDQAPGHDREAEAAVKEKEEGPEPRLTIDEAPQERLRETEGPDFPSPSVPLKASDPEEASQAQEDPGQGDQQVCAEEADPELEPASGGEQEPRPQQAQTKAASQILENGEEAPGPDPSLDRMLSSSSSVSSLNSSTLSGSQMSLSGDAEAVQVRGSVHFALHYEPGAAELRVHVIQCQGLAAARRRRSDPYVKSYLLPDKQSKRKTAVKKRNL Predict reactive species Full Name: synaptotagmin-like 1 Calculated Molecular Weight: 62 kDa Observed Molecular Weight: 70 kDa GenBank Accession Number: BC015764 Gene Symbol: SYTL1 Gene ID (NCBI): 84958 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8IYJ3 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924