Iright
BRAND / VENDOR: Proteintech

Proteintech, 31859-1-AP, RDH12 Polyclonal antibody

CATALOG NUMBER: 31859-1-AP
السعر العادي$0.99
/
  • In stock, ready to ship

  • الطلب مؤجل، سيتم الشحن قريباً

This site is protected by hCaptcha and the hCaptcha Privacy Policy and Terms of Service apply.

Product Description
Size: 20ul / 150ul The RDH12 (31859-1-AP) by Proteintech is a Polyclonal antibody targeting RDH12 in WB, ELISA applications with reactivity to human samples 31859-1-AP targets RDH12 in WB, ELISA applications and shows reactivity with human samples. Tested Applications Positive WB detected in: HEK-293T cells Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Specification Tested Reactivity: human Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag30460 Product name: Recombinant human RDH12 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 242-316 aa of BC025724 Sequence: SLLCLLWRLFSPFVKTAREGAQTSLHCALAEGLEPLSGKYFSDCKRTWVSPRARNNKTAERLWNVSCELLGIRWE Predict reactive species Full Name: retinol dehydrogenase 12 (all-trans/9-cis/11-cis) Calculated Molecular Weight: 316 aa, 35 kDa Observed Molecular Weight: 35 kDa GenBank Accession Number: BC025724 Gene Symbol: RDH12 Gene ID (NCBI): 145226 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q96NR8 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.

Order Guidelines

1. Price & Stock Available on Request. 📧Click to send email to: service@iright.com

2. Please DO NOT make payment before confirmation.

3. Minimum order value of $1,000 USD required.

Collaboration

Tony Tang

📧Email: Tony.Tang@iright.com

📱Mobile/WhatsApp/Wechat: +86-17717886924