Proteintech, 31893-1-AP, NTN3 Polyclonal antibody

Size: 20ul / 150ul The NTN3 (31893-1-AP) by Proteintech is a Polyclonal antibody targeting NTN3 in WB, ELISA applications with reactivity to human, mouse, rat samples 31893-1-AP targets NTN3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:500-1:2000 Background Information NTN3 (Netrin-3), also known as NTN2L. NTN3 (Netrin-3) is predicted to be located in the Golgi apparatus and extracellular region, and it is also predicted to be active in the basement membrane. It is detected in various amounts in the skin, esophagus, bronchus, nasal cavity, kidney, and vagina in healthy human tissues (PMID: 37345154). The protein is predicted to enable signaling receptor binding activity and is involved in animal organ morphogenesis, neuron projection development, and tissue development. Netrins, including NTN3, are a group of proteins that exhibit structural homology to the extracellular matrix protein laminin and influence neurological and tumor progression. NTN3, along with other netrin family members, may play a role in tumor growth and migration in specific organs where they are expressed, potentially affecting disease progression. However, further research is needed to elucidate the precise prognostic and biological implications of NTN3 in various diseases, including cancer (PMID: 32251318). The molecular weight of NTN3 is 62 kDa. It is possible that the protein has glycosylation modification. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag34435 Product name: Recombinant human NTN3 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 28-207 aa of Netrin-3 Sequence: DPCHDEGGAPRGCVPGLVNAALGREVLASSTCGRPATRACDASDPRRAHSPALLTSPGGTASPLCWRSESLPRAPLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEALCFPAPLAQPDGSGLLAFSMQDSSPPGLDLDS Predict reactive species Full Name: netrin 3 Calculated Molecular Weight: 61 kDa Observed Molecular Weight: 62-70 kDa GenBank Accession Number: Netrin-3 Gene Symbol: NTN3 Gene ID (NCBI): 4917 RRID: AB_3670136 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: O00634 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.