Proteintech, 31908-1-AP, FRMD1 Polyclonal antibody

Size: 20ul / 150ul The FRMD1 (31908-1-AP) by Proteintech is a Polyclonal antibody targeting FRMD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 31908-1-AP targets FRMD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: mouse colon tissue, K-562 cells, mouse testis tissue, mouse thymus tissue, rat thymus tissue Recommended dilution Western Blot (WB): WB : 1:1000-1:4000 Background Information The FERM structural domain of FRMD1 (FERM Domain Containing 1) is widely found in cytoskeleton-associated proteins, which are capable of connecting the cytoskeleton to the cell membrane and is involved in signaling. FRMD1 is predicted to be involved in the positive regulation of the Hippo signaling pathway and may play a role in the cytoplasmic side of the cytoskeleton and apical plasma membrane. Although there are fewer studies on the role of FRMD1 in disease, its expression pattern in cancer and lymphoid tissues suggests that it may have important biological functions. Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36382 Product name: Recombinant human FRMD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 205-300 aa of BC137144 Sequence: RYFEPHSYFPQWIITKRGIDYILRHMPTLHRERQGLSPKEAMLCFIQEACRLEDVPVHFFRLHKDKKEGRPTVILGLALRGVHIYQGKKLEIQLDG Predict reactive species Full Name: FERM domain containing 1 Observed Molecular Weight: 70 kDa GenBank Accession Number: BC137144 Gene Symbol: FRMD1 Gene ID (NCBI): 79981 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q8N878 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.