Proteintech, 31912-1-AP, PSMD1 Polyclonal antibody

Size: 20ul / 150ul The PSMD1 (31912-1-AP) by Proteintech is a Polyclonal antibody targeting PSMD1 in WB, ELISA applications with reactivity to human, mouse, rat samples 31912-1-AP targets PSMD1 in WB, ELISA applications and shows reactivity with human, mouse, rat samples. Tested Applications Positive WB detected in: A431 cells, Jurkat cells, SKOV-3 cells, mouse brain tissue, rat brain tissue Recommended dilution Western Blot (WB): WB : 1:5000-1:50000 Specification Tested Reactivity: human, mouse, rat Host / Isotype: Rabbit / IgG Class: Polyclonal Type: Antibody Immunogen: CatNo: Ag36142 Product name: Recombinant human PSMD1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 91-396 aa of BC094720 Sequence: NDNSEYVETIIAKCIDHYTKQCVENADLPEGEKKPIDQRLEGIVNKMFQRCLDDHKYKQAIGIALETRRLDVFEKTILESNDVPGMLAYSLKLCMSLMQNKQFRNKVLRVLVKIYMNLEKPDFINVCQCLIFLDDPQAVSDILEKLVKEDNLLMAYQICFDLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETEEKTSSAFVGKTPEASPEPKDQTLKMIKILSGEMAIELHLQFLIRNNNTDLMILKNTKDAVRNSVCHTATVIANSFMHCGTTSDQFLRDNLEWLARA Predict reactive species Full Name: proteasome (prosome, macropain) 26S subunit, non-ATPase, 1 Calculated Molecular Weight: 953 aa, 106 kDa Observed Molecular Weight: 106 kDa GenBank Accession Number: BC094720 Gene Symbol: PSMD1 Gene ID (NCBI): 5707 RRID: AB_3670140 Conjugate: Unconjugated Form: Liquid Purification Method: Antigen affinity Purification UNIPROT ID: Q99460 Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.